PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F02535.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 366aa    MW: 39336.5 Da    PI: 5.044
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F02535.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF337.7e-11949141
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                    k ien  +r  t+ +Rr g+  K + L +LC++e+++i f 
  Pahal.F02535.1  9 KLIENPKKRRATYKNRRDGLVQKTSQLATLCGVEALLICFD 49
                    569***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-9162IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-15152IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.923148IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-5323IPR002100Transcription factor, MADS-box
CDDcd001206.50E-16351No hitNo description
PfamPF003191.5E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MPRGKLGMKL IENPKKRRAT YKNRRDGLVQ KTSQLATLCG VEALLICFDP KPAGSGQDGG  60
GSAYAVTTWP ADREDVLELI KKYRETPADK IRHSFTAAAY YQEELAKQHR KLLKIEQCGP  120
DMLSLQDCRL ADLSPADLDG LLVTLDETLR KAQQRIVALG GHVEDDGDVP SATATVAAPM  180
PLADYNSFDL AFSVPDAGSM VTQYYYPPLD MLPQPVLPLQ PPCLAYHQMP LPSYTFQMPP  240
PPLDLGMAGT GTVDFRPFAT NFSHGGATGP EFYDDFMPGF DATGGGVYVD DYVIAGGQSF  300
AAGHAGAGYQ HEHNLPAGIL PVSWLNNNPG PMDAAALEER NGYAVLPGSS SSSSSTFFQG  360
GFQKK*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4AK501e-178K4AK50_SETIT; Uncharacterized protein
STRINGSi039273m1e-178(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143511825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-14M-type_MADS family protein